PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.68078s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family G2-like
Protein Properties Length: 483aa    MW: 53365.9 Da    PI: 5.5303
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.68078s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like40.85e-139402556
               G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                          e+A+Pktil+ m+v+g+++++++SHLQkYR +
  Araha.68078s0001.1.p  9 EEAVPKTILQYMNVDGISRSQIASHLQKYRKH 40
                          68****************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.77E-7643IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-11940IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.5E-11944IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 483 aa     Download sequence    Send to blast
MLYFLYHFEE AVPKTILQYM NVDGISRSQI ASHLQKYRKH MRKVKERAKE VNMSKKAMKS  60
NVASSSNINP QGSYKYVRGL SKENLFKAQL GDGPGQPSIL LNNNDSIYSM HDGLTYDLSQ  120
NGSNLLPMGG SHGFSRGMWP LHEESISVLP LNEERRSVFG TSQMSQVPRP GQYGTPSDIS  180
GMNTNLDTGY MRNSYAGISI DKNGHLSGLG GERVSGNDNG YLGESLDAMN WTLNNNIVRN  240
HGSSTSRFSA PFSSFLHNKV QQTDDLLPRS IFDTSQAPQV PSFGQYGITN DVIDMKPDFG  300
TGYMHNNSTG IITDQIGNLV GLGGARVNGN GNVSPGQNLG TMNWNFDENN MSNYGSSNSR  360
FSSPFSLFNE DQSLSHLNAQ TDELVPVLEN LSLYNDHQSI NPFAGNSNFL QYQHQGQVSD  420
TNFQFANDDQ LEKNAMLAAC SIEDINNLSI NNVKESSNEE TLNSIAANLE MLFPTHDMNI  480
INQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0168801e-111AB016880.1 Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MTG10.
GenBankCP0026881e-111CP002688.1 Arabidopsis thaliana chromosome 5 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002866471.10.0hypothetical protein ARALYDRAFT_332444
TrEMBLD7MLA40.0D7MLA4_ARALL; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_80017870.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM1744179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62110.11e-174G2-like family protein